Characterization of a Diuretic Peptide frontLocusta migratoria
- 1 January 1991
- journal article
- research article
- Published by Walter de Gruyter GmbH in Biological Chemistry Hoppe-Seyler
- Vol. 372 (2) , 929-934
- https://doi.org/10.1515/bchm3.1991.372.2.929
Abstract
A diuretic peptide Locusta-DP, identified by its ability to increase cyclic AMP production in locust Malpighian tubules in vitro, has been isolated and characterized from whole heads of Locusta migratoria. The purified peptide stimulates fluid secretion by Malpighian tubules maximally in vitro. The primary structure of Locusta-DP was established as a 46 residue amidated peptide: MGMGPSLSIVNPMDVLRQRLLLEIARRRLRDAEEQIKANKDFLQQI-NH2. Locusta-DP has 48% sequence identity with Acheta-DP and 49% identity with Manduca-DH, and provides further evidence for the presence of a family of diuretic peptides in insects.Keywords
This publication has 3 references indexed in Scilit:
- Assay and characterisation of diuretic factors in insectsJournal of Insect Physiology, 1990
- Endocrine regulation of diuresis in insectsJournal of Insect Physiology, 1990
- Identification of an arginine vasopressin-like diuretic hormone from LocustamigratoriaBiochemical and Biophysical Research Communications, 1987