Purification of macrophage migration inhibitory factor (MIF) from bovine brain cytosol
- 22 March 1993
- journal article
- research article
- Published by Wiley in FEBS Letters
- Vol. 319 (3) , 233-236
- https://doi.org/10.1016/0014-5793(93)80553-7
Abstract
Two isoforms of the macrophage migration inhibitory factor (MIF) have been isolated to homogeneity from bovine brain cytosol. In agreement with the cDNA sequence of their human counterpart, they both have an apparent molecular weight of 12 kDa and are characterized by the following N‐terminal amino acid sequence NH2‐PMFVVNTNVPRASVPDGLLSELTQQLAQATGKPPQYIAV‐. CD spectra revealed that bovine MIF contains 42% (±3%) α‐helix and 21% (±3%) β‐structure. CD‐constrained prediction of the secondary structure assigned MIF to the α/β‐class of proteins.Keywords
This publication has 14 references indexed in Scilit:
- Hydrophobicity scales and computational techniques for detecting amphipathic structures in proteinsPublished by Elsevier ,2005
- A rapamycin-selective 25-kDa immunophilinBiochemistry, 1992
- Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.Proceedings of the National Academy of Sciences, 1989
- Interleukin 4 induces cultured monocytes/macrophages to form giant multinucleated cells.The Journal of Experimental Medicine, 1988
- Two calcium-binding proteins in infiltrate macrophages of rheumatoid arthritisNature, 1987
- Improved silver staining of plant proteins, RNA and DNA in polyacrylamide gelsElectrophoresis, 1987
- A simple method for displaying the hydropathic character of a proteinJournal of Molecular Biology, 1982
- Delayed hypersensitivity in vitro: its mediation by cell-free substances formed by lymphoid cell-antigen interaction.Proceedings of the National Academy of Sciences, 1966
- Mechanism of a Reaction in Vitro Associated with Delayed-Type HypersensitivityScience, 1966
- In vitro Studies on Homograft SensitivityNature, 1965